PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1066.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family G2-like
Protein Properties Length: 405aa    MW: 44553.9 Da    PI: 9.1986
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1066.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32290343255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  evm.model.supercontig_1066.1 290 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 343
                                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15287343IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28288343IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-24290343IPR006447Myb domain, plants
PfamPF002497.2E-7291342IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MPLESVFIEP NTSSNPLPDL SLHISLPNTA SSSSSSSSCN AAINGADTSF NNFLGRRRED  60
DKSSSRTSIR TSSQAYTELS LAHPANSMDD QADLHTQSVR NFRGGAQELA FPSLQNYPFH  120
NHHHLHHSNH NNSHLNHINH GVSLLEVSDG LRPIKGIPVY HNRSFPFMPL EQHTRQKDQT  180
KMSFYQMPPP YNPSSSPSSV INSMSSSSSP SSPYYGLDPM SILSSAGPNN QSGYRVPTSR  240
FNGVFSVDSS KSQHLHHHNQ YAAGSSDASH GIIRSRFLPK LPAKRSMRAP RMRWTSTLHA  300
RFVHAVELLG GHERATPKSV LELMDVKDLT LAHVKSHLQM YRTVKTTDKP AASSGQSDGS  360
GEEDISTMGS GRRSTDHQRG QPDGSLQQEM DFPSTATTLW SNSSX
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266463.11e-140PREDICTED: transcription repressor KAN1 isoform X1
TrEMBLA5AFB91e-140A5AFB9_VITVI; Putative uncharacterized protein
TrEMBLF6HI081e-140F6HI08_VITVI; Putative uncharacterized protein
STRINGVIT_04s0043g00340.t011e-140(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.19e-59G2-like family protein